(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0966

AL596167.LIN0966     Location/Qualifiers
FT   CDS             25620..26288
FT                   /transl_table=11
FT                   /gene="lin0966"
FT                   /note="similar to B. subtilis YjbM protein"
FT                   /db_xref="GOA:Q7AP16"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP16"
FT                   /protein_id="CAC96197.1"
FT                   /translation="MNHWEDFLAPYKQAVEELKIKLKGMRSQFELENNHSPIEFVTGRV
FT                   KPVASILDKANQKHIALDHLVEEMQDIAGLRMMCQFVDDIEVVVRLLRQRNDFRIVEER
FT                   DYITNKKPSGYRSYHVVIEYPVETIQGEKKILAEIQIRTLAMNFWATIEHSVNYKYQGE
FT                   FPEAINKRLKRAAEAAFQLDEEMSQIREEIQEAQVYFSQNKDVSKDKKAVHQVMPKKNK
FT                   "
     MNHWEDFLAP YKQAVEELKI KLKGMRSQFE LENNHSPIEF VTGRVKPVAS ILDKANQKHI        60
     ALDHLVEEMQ DIAGLRMMCQ FVDDIEVVVR LLRQRNDFRI VEERDYITNK KPSGYRSYHV       120
     VIEYPVETIQ GEKKILAEIQ IRTLAMNFWA TIEHSVNYKY QGEFPEAINK RLKRAAEAAF       180
     QLDEEMSQIR EEIQEAQVYF SQNKDVSKDK KAVHQVMPKK NK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page