(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0967

AL596167.LIN0967     Location/Qualifiers
FT   CDS             26320..27114
FT                   /transl_table=11
FT                   /gene="lin0967"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YjbN protein"
FT                   /db_xref="GOA:Q92D53"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D53"
FT                   /protein_id="CAC96198.1"
FT                   /translation="MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDEIEPEIVISIGGD
FT                   GTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLK
FT                   TTVKYGIGKKEAEYLALNESTVKSSGGPFVVDVVINDLHFERFRGDGLCMSTPSGTTAY
FT                   NKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVD
FT                   HLSILHRDVQEIRYEVSAKKVHFARFRSFPFWRRVHDSFIED"
     MKYMITSKGD EKSDLLRLNM IAGFGEYDME YDEIEPEIVI SIGGDGTFLS AFHQYEERLD        60
     EIAFIGIHTG HLGFYADWRP AEADKLVKLL AKGEYQKVSY PLLKTTVKYG IGKKEAEYLA       120
     LNESTVKSSG GPFVVDVVIN DLHFERFRGD GLCMSTPSGT TAYNKSLGGA LMHPSIEAMQ       180
     LTEMASINNR VYRTIGSPLV FPKHHVVSLQ PVNDKDFQIS VDHLSILHRD VQEIRYEVSA       240
     KKVHFARFRS FPFWRRVHDS FIED                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page