(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0968

AL596167.LIN0968     Location/Qualifiers
FT   CDS             27133..28023
FT                   /transl_table=11
FT                   /gene="lin0968"
FT                   /note="similar to ribosomal large subunit pseudouridine
FT                   synthetase"
FT                   /db_xref="GOA:Q92D52"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D52"
FT                   /protein_id="CAC96199.1"
FT                   /translation="MFLEWQVKNEEDGLLLRTFLKSKHISKQLLTAVKFGADGKIEVNN
FT                   EEQNVLYHVKTDDKVRLTFPTEQQNDRLLAEHTDLEVVFEDDFLLIINKPAGMASIPSQ
FT                   YHPTGSVANFVKGHYENQGLTSAIHIVTRLDRETSGLMLIAKNRYAHARLSSFLQQGLL
FT                   KRRYQAFTSGTLEEEAGSIEAPIGRKDVSIMERFVTPEGKYAKTNYEVLMRYNGFDHLA
FT                   IQLETGRTHQIRVHFSYIGHPLIGDDMYGGDQELLKRQALHSCHLHLVHPVTEEYMAFD
FT                   LPLPEDMEQIIQKSK"
     MFLEWQVKNE EDGLLLRTFL KSKHISKQLL TAVKFGADGK IEVNNEEQNV LYHVKTDDKV        60
     RLTFPTEQQN DRLLAEHTDL EVVFEDDFLL IINKPAGMAS IPSQYHPTGS VANFVKGHYE       120
     NQGLTSAIHI VTRLDRETSG LMLIAKNRYA HARLSSFLQQ GLLKRRYQAF TSGTLEEEAG       180
     SIEAPIGRKD VSIMERFVTP EGKYAKTNYE VLMRYNGFDH LAIQLETGRT HQIRVHFSYI       240
     GHPLIGDDMY GGDQELLKRQ ALHSCHLHLV HPVTEEYMAF DLPLPEDMEQ IIQKSK           296
//

If you have problems or comments...

PBIL Back to PBIL home page