(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0969

AL596167.LIN0969     Location/Qualifiers
FT   CDS             28101..28889
FT                   /transl_table=11
FT                   /gene="lin0969"
FT                   /note="similar to enoyl- acyl-carrier protein reductase"
FT                   /db_xref="GOA:Q92D51"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D51"
FT                   /protein_id="CAC96200.1"
FT                   /translation="MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRA
FT                   KKSITELVPSLNEINQDPLILACDVTSEDAITATFETIKDKAGKLSGLAHCIAFANKDY
FT                   LTGDYLEVDRKSFLQAHEISAYSFTAVARALKHLDMLTEDASLLTLTYLGGERVVENYN
FT                   IMGVAKASLDASVRYLAMDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPL
FT                   KRATQAEEVGDTAYYLFSNLSRGVTGEVIHVDSGYHIIGF"
     MNLSLEGKTY VVMGVANKRS IAWAIARSLN EAGAKLVFTY ADDRAKKSIT ELVPSLNEIN        60
     QDPLILACDV TSEDAITATF ETIKDKAGKL SGLAHCIAFA NKDYLTGDYL EVDRKSFLQA       120
     HEISAYSFTA VARALKHLDM LTEDASLLTL TYLGGERVVE NYNIMGVAKA SLDASVRYLA       180
     MDLGAIGVRV NAISAGPIRT VSARGVSGFS DSISLVEERA PLKRATQAEE VGDTAYYLFS       240
     NLSRGVTGEV IHVDSGYHII GF                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page