(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0975

AL596167.LIN0975     Location/Qualifiers
FT   CDS             complement(34271..34708)
FT                   /transl_table=11
FT                   /gene="lin0975"
FT                   /note="similar to B. subtilis YjcF protein"
FT                   /db_xref="GOA:Q92D45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D45"
FT                   /protein_id="CAC96206.1"
FT                   /translation="MTVKKVTDELGKQAALKIRNDVFVVEQNVDPALEWDEFDEMASVD
FT                   MFVDYAEDGTALATGRFRVKDGYGKVERICTQKIARGSGSGRRIMEAIELEAKTRGLTT
FT                   LKLGAQLTAIPFYEKLGYETCSDVFLDAGIKHKEMKKTLTY"
     MTVKKVTDEL GKQAALKIRN DVFVVEQNVD PALEWDEFDE MASVDMFVDY AEDGTALATG        60
     RFRVKDGYGK VERICTQKIA RGSGSGRRIM EAIELEAKTR GLTTLKLGAQ LTAIPFYEKL       120
     GYETCSDVFL DAGIKHKEMK KTLTY                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page