(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0976

AL596167.LIN0976     Location/Qualifiers
FT   CDS             complement(34725..35474)
FT                   /transl_table=11
FT                   /gene="lin0976"
FT                   /note="similar to B. subtilis YjcH protein"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D44"
FT                   /protein_id="CAC96207.1"
FT                   /translation="MTAHKMLDEKFYSKLLGEELDLIICLPPDFSPLYKYPLFIVQDGK
FT                   DYFQFGKLARHSEELAVNEQIQKAIFIGIPYKTVMDRREKYHPDGEQNEAYIRFLAFEL
FT                   VPYLEERFPSFQMPTSRFLMGDSLGASVSLKAALLFPFTFGNVILHSPYVDDAILTLAE
FT                   KADPAKVKIYHIIGDQETAVETTGDEILDFLSPNKSLEQILTSRGFDYYFRVFNGDHRW
FT                   KYWQPFIKESLQFMLPVNTFDLESMRA"
     MTAHKMLDEK FYSKLLGEEL DLIICLPPDF SPLYKYPLFI VQDGKDYFQF GKLARHSEEL        60
     AVNEQIQKAI FIGIPYKTVM DRREKYHPDG EQNEAYIRFL AFELVPYLEE RFPSFQMPTS       120
     RFLMGDSLGA SVSLKAALLF PFTFGNVILH SPYVDDAILT LAEKADPAKV KIYHIIGDQE       180
     TAVETTGDEI LDFLSPNKSL EQILTSRGFD YYFRVFNGDH RWKYWQPFIK ESLQFMLPVN       240
     TFDLESMRA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page