(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0977

AL596167.LIN0977     Location/Qualifiers
FT   CDS             35693..36712
FT                   /transl_table=11
FT                   /gene="lin0977"
FT                   /note="similar to branched-chain amino acid
FT                   aminotransferase"
FT                   /db_xref="GOA:Q92D43"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D43"
FT                   /protein_id="CAC96208.1"
FT                   /translation="MSKDIDWSNLGFSYIKTDKRYISHWKDGAWDEGTLTEDNTLHISE
FT                   GSTALHYGQQCFEGLKAYRCKDGSINLFRPDRNAARIQKSCERLLMPHIPTEKFIDACM
FT                   QVVRANEEFVPPYGTGATLYLRPFVIGVGDNIGVHAAPEYIFSVFCSPVGPYFKGGMAP
FT                   TNFIVSDFDRAAPNGTGAAKVGGNYAASLLPGQNAKDRNFGDCIYLDPATHTKIEEVGS
FT                   ANFFGITKDDKFITPYSPSILPSITKYSLLYLAEHRLGLKAEEGDVFIDKLDEFKEAGA
FT                   CGTAAVITPIGGIQTKDDFHVFYSETEVGPVTKRLFDELCGIQFGDVEAPEGWIYKVK"
     MSKDIDWSNL GFSYIKTDKR YISHWKDGAW DEGTLTEDNT LHISEGSTAL HYGQQCFEGL        60
     KAYRCKDGSI NLFRPDRNAA RIQKSCERLL MPHIPTEKFI DACMQVVRAN EEFVPPYGTG       120
     ATLYLRPFVI GVGDNIGVHA APEYIFSVFC SPVGPYFKGG MAPTNFIVSD FDRAAPNGTG       180
     AAKVGGNYAA SLLPGQNAKD RNFGDCIYLD PATHTKIEEV GSANFFGITK DDKFITPYSP       240
     SILPSITKYS LLYLAEHRLG LKAEEGDVFI DKLDEFKEAG ACGTAAVITP IGGIQTKDDF       300
     HVFYSETEVG PVTKRLFDEL CGIQFGDVEA PEGWIYKVK                              339
//

If you have problems or comments...

PBIL Back to PBIL home page