(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0985

AL596167.LIN0985     Location/Qualifiers
FT   CDS             42626..43537
FT                   /transl_table=11
FT                   /gene="lin0985"
FT                   /note="similar to antibiotic ABC transporter, ATP-binding
FT                   protein,"
FT                   /db_xref="GOA:Q92D35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D35"
FT                   /protein_id="CAC96216.1"
FT                   /translation="MIKLTNVVKTFGKVEAVKGINLEVEKGSLFAFLGENGAGKSTTLS
FT                   MICTESEPTSGEIFIDDEKLTFKNRKNFRQKLGVVFQENVLDDLLTVRENLYNRASLYG
FT                   KTKAEITERLELVSSIMGIEDILNRRFEKLSGGQKRRAEIARAIMHDPEILLLDEPTTG
FT                   LDPKTRVSVWKIIDYLREEFGMTVFLTTHYLEEAKDADQLAVIHKGNIIAQGTPANIRS
FT                   RFSVDKIFFYDANVEELQVIIEKANLPYKVSKGTIRVDVIDENIGILAILNQAAGLYSS
FT                   FEVIKGNLDDAFISMIKEDSND"
     MIKLTNVVKT FGKVEAVKGI NLEVEKGSLF AFLGENGAGK STTLSMICTE SEPTSGEIFI        60
     DDEKLTFKNR KNFRQKLGVV FQENVLDDLL TVRENLYNRA SLYGKTKAEI TERLELVSSI       120
     MGIEDILNRR FEKLSGGQKR RAEIARAIMH DPEILLLDEP TTGLDPKTRV SVWKIIDYLR       180
     EEFGMTVFLT THYLEEAKDA DQLAVIHKGN IIAQGTPANI RSRFSVDKIF FYDANVEELQ       240
     VIIEKANLPY KVSKGTIRVD VIDENIGILA ILNQAAGLYS SFEVIKGNLD DAFISMIKED       300
     SND                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page