(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0986

AL596167.LIN0986     Location/Qualifiers
FT   CDS             43530..44384
FT                   /transl_table=11
FT                   /gene="lin0986"
FT                   /note="similar to Streptococcus agalactiae CylB protein"
FT                   /db_xref="GOA:Q92D34"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D34"
FT                   /protein_id="CAC96217.1"
FT                   /translation="MISRNLKIYFRDRTAVFMSLLTILIIIGLYAIFLGNNMEEMFKQA
FT                   SGKTIGIQELVNTWVIAGILSITPVTVSLAVFSLKVHDEEQSIARSFAITPASRWRIVA
FT                   SYIVSGLVASFVLSVITLFVGEMYIWLTGGAFLPLESWVSLIGIILINVLCCSSIMFFI
FT                   ASLVKKASAFSSVSTIVGTVIGFIAGIYLPIGSLPAAVQTAMKCFPFTYGASTIREIMT
FT                   KEPLQQVFAGNTQAMDATKEMIGITIYWGDKTVTTGVSLLILSVFAVLFGILSVVLMKR
FT                   QTK"
     MISRNLKIYF RDRTAVFMSL LTILIIIGLY AIFLGNNMEE MFKQASGKTI GIQELVNTWV        60
     IAGILSITPV TVSLAVFSLK VHDEEQSIAR SFAITPASRW RIVASYIVSG LVASFVLSVI       120
     TLFVGEMYIW LTGGAFLPLE SWVSLIGIIL INVLCCSSIM FFIASLVKKA SAFSSVSTIV       180
     GTVIGFIAGI YLPIGSLPAA VQTAMKCFPF TYGASTIREI MTKEPLQQVF AGNTQAMDAT       240
     KEMIGITIYW GDKTVTTGVS LLILSVFAVL FGILSVVLMK RQTK                        284
//

If you have problems or comments...

PBIL Back to PBIL home page