(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0987

AL596167.LIN0987     Location/Qualifiers
FT   CDS             44466..46034
FT                   /transl_table=11
FT                   /gene="lin0987"
FT                   /note="similar to peptide chain release factor 3 (RF-3)"
FT                   /db_xref="GOA:Q92D33"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D33"
FT                   /protein_id="CAC96218.1"
FT                   /translation="MSQDLQKEVASRKTFAIISHPDAGKTTITEQLLLFGGVIRSAGTV
FT                   KGKKSGKFATSDWMEIEKQRGISVTSSVMQFDYNGSRINILDTPGHSDFSEDTYRTLMA
FT                   VDSAVMVIDAAKGIEAQTLKLFKVCRMRGIPIFTFINKMDRQGKMPLELLAELEEVLGI
FT                   ESYPMNWPIGMGKELAGIYDRYHRVIEQYRSEEDERFLPLGEDGDLKEVHAIQKSLYYD
FT                   QALEEIMLLDEAGNDFSRERIIAGEQTPVFFGSALTNFGVETFLRTFVDFAPSPSSHES
FT                   NEGVIEADNPKFSGFIFKIQANMNPAHRDRIAFIRICSGEFERGMNVTLTRTGKSMKLA
FT                   NSTQFMADDRETVNRAVAGDIIGLYDTGNYQIGDTITNGSKKLEFEKLPQFTPELFMRV
FT                   YAKNVMKQKHFHKGVEQLVQEGAIQLFKTWRTEEYIIGAVGQLQFEVFEHRMRGEYNSE
FT                   IRMEPIGKKIARWVKEEDADEKLSTARSMLVKDRFDQPLFLFENEFAINWFNDKNPDIE
FT                   LTSLL"
     MSQDLQKEVA SRKTFAIISH PDAGKTTITE QLLLFGGVIR SAGTVKGKKS GKFATSDWME        60
     IEKQRGISVT SSVMQFDYNG SRINILDTPG HSDFSEDTYR TLMAVDSAVM VIDAAKGIEA       120
     QTLKLFKVCR MRGIPIFTFI NKMDRQGKMP LELLAELEEV LGIESYPMNW PIGMGKELAG       180
     IYDRYHRVIE QYRSEEDERF LPLGEDGDLK EVHAIQKSLY YDQALEEIML LDEAGNDFSR       240
     ERIIAGEQTP VFFGSALTNF GVETFLRTFV DFAPSPSSHE SNEGVIEADN PKFSGFIFKI       300
     QANMNPAHRD RIAFIRICSG EFERGMNVTL TRTGKSMKLA NSTQFMADDR ETVNRAVAGD       360
     IIGLYDTGNY QIGDTITNGS KKLEFEKLPQ FTPELFMRVY AKNVMKQKHF HKGVEQLVQE       420
     GAIQLFKTWR TEEYIIGAVG QLQFEVFEHR MRGEYNSEIR MEPIGKKIAR WVKEEDADEK       480
     LSTARSMLVK DRFDQPLFLF ENEFAINWFN DKNPDIELTS LL                          522
//

If you have problems or comments...

PBIL Back to PBIL home page