(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0989

AL596167.LIN0989     Location/Qualifiers
FT   CDS             46622..47983
FT                   /transl_table=11
FT                   /gene="lin0989"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D31"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D31"
FT                   /protein_id="CAC96220.1"
FT                   /translation="MKHSDNYYLTKASIPKAIAHLSIPMMLGMSVGVIYNIINAFFIGL
FT                   LHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEDGIKAKQVSAFVLYGSL
FT                   VLGIICAIILGFLINPVTHFLGADATSFLHTKNYTLALLICSPFIIANFALEQVVRAEG
FT                   ASRISMNGMLIGTLVNLVFDPLLILYFNFNVVGAAVSIGIASTVSLIYYAWYLEKKSDY
FT                   LSIRFKWFKATKEIVQNVFKIGVSELLLSLFLIVTTLVLNHYSMIYGEGVVAGFGVALR
FT                   VVQLPEFICMGLYMGIIPLLAYNFSAGNIARFEKAIRFTAVSIGLIVLVISSFVFIFRF
FT                   QVMHLFSDSQSVISLGVHIMVAMLISSLFSGFTGLFTSTFQAIGKAIPATIMSVSQGII
FT                   FIPVIILGQHYFGLMGVIWSLTTTEILTCLIGVILFTIHNIKIASSAKTKDLAV"
     MKHSDNYYLT KASIPKAIAH LSIPMMLGMS VGVIYNIINA FFIGLLHDTS MLTAVTLGLP        60
     MFTILMAIGN MFGVGGGTYI SRLLGKEDGI KAKQVSAFVL YGSLVLGIIC AIILGFLINP       120
     VTHFLGADAT SFLHTKNYTL ALLICSPFII ANFALEQVVR AEGASRISMN GMLIGTLVNL       180
     VFDPLLILYF NFNVVGAAVS IGIASTVSLI YYAWYLEKKS DYLSIRFKWF KATKEIVQNV       240
     FKIGVSELLL SLFLIVTTLV LNHYSMIYGE GVVAGFGVAL RVVQLPEFIC MGLYMGIIPL       300
     LAYNFSAGNI ARFEKAIRFT AVSIGLIVLV ISSFVFIFRF QVMHLFSDSQ SVISLGVHIM       360
     VAMLISSLFS GFTGLFTSTF QAIGKAIPAT IMSVSQGIIF IPVIILGQHY FGLMGVIWSL       420
     TTTEILTCLI GVILFTIHNI KIASSAKTKD LAV                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page