(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0990

AL596167.LIN0990     Location/Qualifiers
FT   CDS             48264..49031
FT                   /transl_table=11
FT                   /gene="lin0990"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D30"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D30"
FT                   /protein_id="CAC96221.1"
FT                   /translation="MDTAMILEYGWVLLVLIGLEGILAADNAVVMAVMVKHLPDKQQKK
FT                   ALFYGLMGAFVFRFGALFLISFLANVWQVQALGAAYLLYIAISHIWKHAKGKDGEKEKK
FT                   EKAGSGFWMTVLKVEIADIAFAIDSMLAAVALAITLPETGWGHIGGIDTGQFAIMFLGG
FT                   LVGLIIIRFAATQFVKLLKSYPSLETAAFLIVGWVGVKLVIYTLAHPSLGVIPHSFPES
FT                   TLWKLIFWGVMILIILWGWFVSYRSKKKTETTK"
     MDTAMILEYG WVLLVLIGLE GILAADNAVV MAVMVKHLPD KQQKKALFYG LMGAFVFRFG        60
     ALFLISFLAN VWQVQALGAA YLLYIAISHI WKHAKGKDGE KEKKEKAGSG FWMTVLKVEI       120
     ADIAFAIDSM LAAVALAITL PETGWGHIGG IDTGQFAIMF LGGLVGLIII RFAATQFVKL       180
     LKSYPSLETA AFLIVGWVGV KLVIYTLAHP SLGVIPHSFP ESTLWKLIFW GVMILIILWG       240
     WFVSYRSKKK TETTK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page