(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0991

AL596167.LIN0991     Location/Qualifiers
FT   CDS             49136..49903
FT                   /transl_table=11
FT                   /gene="lin0991"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D29"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D29"
FT                   /protein_id="CAC96222.1"
FT                   /translation="MDVSIWGEYALVFLVLVVLEGILSADNAVVMAVIVKGLPHDKQRK
FT                   ALFYGLVGAFVFRFVALFLISFLVKIWEIQAIGAVYLLYLAIKHMWRLKKGKQEEVKEA
FT                   SEAKSTSFWGVVARVELTDIAFALDSMLAAAALVVTLPDLGNFDIGGMNGGQFIVMFLG
FT                   GIAGLVVIRFAATQVVKLLERYPTLETAAFLIVGWVGVKMAVLTLAHPSVAIIPEDFPD
FT                   SAVWKLTFWSVMIIIGLGGYIIARKKEKKTKRV"
     MDVSIWGEYA LVFLVLVVLE GILSADNAVV MAVIVKGLPH DKQRKALFYG LVGAFVFRFV        60
     ALFLISFLVK IWEIQAIGAV YLLYLAIKHM WRLKKGKQEE VKEASEAKST SFWGVVARVE       120
     LTDIAFALDS MLAAAALVVT LPDLGNFDIG GMNGGQFIVM FLGGIAGLVV IRFAATQVVK       180
     LLERYPTLET AAFLIVGWVG VKMAVLTLAH PSVAIIPEDF PDSAVWKLTF WSVMIIIGLG       240
     GYIIARKKEK KTKRV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page