(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0992

AL596167.LIN0992     Location/Qualifiers
FT   CDS             49944..51281
FT                   /transl_table=11
FT                   /gene="lin0992"
FT                   /note="similar to Na+-transporting ATP synthase subunit J"
FT                   /db_xref="GOA:Q92D28"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D28"
FT                   /protein_id="CAC96223.1"
FT                   /translation="MLARMTPVQVIIAYYFIAVTISTIVLSLPFTLQKGVKVSFIDTLF
FT                   TAASSVSVTGLATVDVSQTYSTAGIWVLMAIFQIGGLGVMMISTFFYLILKRRIGLKQR
FT                   QLIMTDTNQFTMSGMVRMLREILVLIFGIELVGALILGIYFIPLYPNFWEAMFQGLYNS
FT                   VSLVTNAGVDITGKSLIPFANDYFVQFISILLIIAGAIGFPVLLETRRFLFEKNTLIPF
FT                   RFSLFVKVTTLTYFVLLIVGGLLIWLFEYNHFFSGKSWDFGFFNSMFLSATSRSAGLQT
FT                   MDSGALSVSTLLLVSFLMFIGASPSSVGGGIRTTTFAITILFIYSVIRGRKHVYIFGRE
FT                   LHQEDVRKSLAVTLVAGFLSISAIVILMQTETASLISVIFEVFSAFGTSGLSVGLTPDL
FT                   STPGKLIIIVLMFIGRVGIMYSMLSLRNKNQPKNAIRLPKEKIITG"
     MLARMTPVQV IIAYYFIAVT ISTIVLSLPF TLQKGVKVSF IDTLFTAASS VSVTGLATVD        60
     VSQTYSTAGI WVLMAIFQIG GLGVMMISTF FYLILKRRIG LKQRQLIMTD TNQFTMSGMV       120
     RMLREILVLI FGIELVGALI LGIYFIPLYP NFWEAMFQGL YNSVSLVTNA GVDITGKSLI       180
     PFANDYFVQF ISILLIIAGA IGFPVLLETR RFLFEKNTLI PFRFSLFVKV TTLTYFVLLI       240
     VGGLLIWLFE YNHFFSGKSW DFGFFNSMFL SATSRSAGLQ TMDSGALSVS TLLLVSFLMF       300
     IGASPSSVGG GIRTTTFAIT ILFIYSVIRG RKHVYIFGRE LHQEDVRKSL AVTLVAGFLS       360
     ISAIVILMQT ETASLISVIF EVFSAFGTSG LSVGLTPDLS TPGKLIIIVL MFIGRVGIMY       420
     SMLSLRNKNQ PKNAIRLPKE KIITG                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page