(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0994

AL596167.LIN0994     Location/Qualifiers
FT   CDS             complement(51761..52792)
FT                   /transl_table=11
FT                   /gene="lin0994"
FT                   /note="similar to B. subtilis YkrP protein"
FT                   /db_xref="GOA:Q92D26"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D26"
FT                   /protein_id="CAC96225.1"
FT                   /translation="MEQTEIKRESYFDNAKFILIFLVVFGHFLQTFITEYAGVRVLYIY
FT                   IYTFHMPAFILISGFFAKSFGKPGYLKKTMKKLILPYVFFQLIYSIFYYFLLNKENLSI
FT                   KFLDPEWSLWFLLSLFFWNLMLLVFSKIKPWKSVSIALLLGLVAGYFDIIGGYLSLSRT
FT                   LVFFPFFLVGYFLKKEHFYFLKTHIASIVGGIFVVLLLIFITMHPNLNDKWFLGSKPYA
FT                   NFVEVKSLGLFIRALVYMISFCSIAAFFSFIPQKRLFFTKWGKNTLYVYLLHGFFIKFF
FT                   REGGQTDFQYSPSTFLLLFGITFGLTVLLSSRLVKTVVQPVIELRASMLYNVFSRLTKR
FT                   ESY"
     MEQTEIKRES YFDNAKFILI FLVVFGHFLQ TFITEYAGVR VLYIYIYTFH MPAFILISGF        60
     FAKSFGKPGY LKKTMKKLIL PYVFFQLIYS IFYYFLLNKE NLSIKFLDPE WSLWFLLSLF       120
     FWNLMLLVFS KIKPWKSVSI ALLLGLVAGY FDIIGGYLSL SRTLVFFPFF LVGYFLKKEH       180
     FYFLKTHIAS IVGGIFVVLL LIFITMHPNL NDKWFLGSKP YANFVEVKSL GLFIRALVYM       240
     ISFCSIAAFF SFIPQKRLFF TKWGKNTLYV YLLHGFFIKF FREGGQTDFQ YSPSTFLLLF       300
     GITFGLTVLL SSRLVKTVVQ PVIELRASML YNVFSRLTKR ESY                         343
//

If you have problems or comments...

PBIL Back to PBIL home page