(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0995

AL596167.LIN0995     Location/Qualifiers
FT   CDS             52980..53459
FT                   /transl_table=11
FT                   /gene="lin0995"
FT                   /note="similar to methylated-DNA-protein-cystein
FT                   methyltransferase "
FT                   /db_xref="GOA:Q92D25"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D25"
FT                   /protein_id="CAC96226.1"
FT                   /translation="MLKQTSDSPVGTLFIIIEDAHITKISYDEPTNWEILAGEKGEIAI
FT                   YQQLLEQLAGYFEGEREVFDLPIFLQGTPFQQRVWQALSEIPYGVVVSYKDIAIAAGSP
FT                   KAVQAVGQANRANPIPILIPCHRCVKSDGALGGYNGADIDKKQYLLALEKGLRLS"
     MLKQTSDSPV GTLFIIIEDA HITKISYDEP TNWEILAGEK GEIAIYQQLL EQLAGYFEGE        60
     REVFDLPIFL QGTPFQQRVW QALSEIPYGV VVSYKDIAIA AGSPKAVQAV GQANRANPIP       120
     ILIPCHRCVK SDGALGGYNG ADIDKKQYLL ALEKGLRLS                              159
//

If you have problems or comments...

PBIL Back to PBIL home page