(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0997

AL596167.LIN0997     Location/Qualifiers
FT   CDS             complement(55813..56424)
FT                   /transl_table=11
FT                   /gene="lin0997"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="GOA:Q92D23"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D23"
FT                   /protein_id="CAC96228.1"
FT                   /translation="MKSIKIDYKLVLGLILCALLVILTYQFPRVFWYLYGAGMLFLLSF
FT                   VIFNDDLKKEFSFVKGILPGIFSGIVLYIIFYIGAFIIKVMPGGLEHSVEAAFNKYSTH
FT                   SLVIWLLLIVAIIPGEEIFWRGFVLKRLNHYFNHWFSNIFAALLCMVMMLPSGNFAAII
FT                   GIFVASLVWNVMYSYRPSLLMVYLSHLTFAFLLLAALPIY"
     MKSIKIDYKL VLGLILCALL VILTYQFPRV FWYLYGAGML FLLSFVIFND DLKKEFSFVK        60
     GILPGIFSGI VLYIIFYIGA FIIKVMPGGL EHSVEAAFNK YSTHSLVIWL LLIVAIIPGE       120
     EIFWRGFVLK RLNHYFNHWF SNIFAALLCM VMMLPSGNFA AIIGIFVASL VWNVMYSYRP       180
     SLLMVYLSHL TFAFLLLAAL PIY                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page