(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1000

AL596167.LIN1000     Location/Qualifiers
FT   CDS             complement(58943..59212)
FT                   /transl_table=11
FT                   /gene="lin1000"
FT                   /note="similar to B. subtilis protein YkvS"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D20"
FT                   /protein_id="CAC96231.1"
FT                   /translation="MHTFFFIKINATPKIEGVITMAKAHVGDIIEFKDGLTGIVEKLNE
FT                   NSVIVDLTYMENFKDLGIEEKTVVNHKNYQIIHSVEEDEEETEE"
     MHTFFFIKIN ATPKIEGVIT MAKAHVGDII EFKDGLTGIV EKLNENSVIV DLTYMENFKD        60
     LGIEEKTVVN HKNYQIIHSV EEDEEETEE                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page