(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1002

AL596167.LIN1002     Location/Qualifiers
FT   CDS             59787..61505
FT                   /transl_table=11
FT                   /gene="lin1002"
FT                   /product="phosphotransferase system enzyme I"
FT                   /db_xref="GOA:Q92D19"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D19"
FT                   /protein_id="CAC96233.1"
FT                   /translation="MAKELKGIAASDGIAIAKAYLLVEPDLSYEKTEVTDVESEVKRFE
FT                   SALEVSRTELSTIREKAAKDLGEDKAQIFDAHLLVLNDPELTGPIEESIKNAKTNAETA
FT                   LQETTDMFIGMFESMDNEYMRERAADIKDVRKRVLSHLLGVTIPNPALIDEEVVVVAAD
FT                   LTPSDTAQLNRKFVKGFVTDIGGRTSHSAIMARSLEIPAVVGTKEVTASVAKNDIVIID
FT                   GLEGNVIIHPTEEQIAHYEKIKSDFALQQAEWEKLKNEKTVSKDGVHVELAANIGTPND
FT                   LEGVISNGGEAVGLYRTEFLYMGRDNFPTEEEQFEAYKAVVSGMDGKSVVVRTLDIGGD
FT                   KTLPYLELPEEMNPFLGFRAIRLCFANEELFRTQLRALLRASVYGNLKIMFPMIATVNE
FT                   FRQARDILLDEKAKLKAAGTEVSDSIELGIMIEIPAAAVLADQFAKEVDFFSIGTNDLI
FT                   QYTMAADRMNERVSYLYQPYNPSILRLVKMVIDASHKEGKWTGMCGEMAGDQTAVPLLL
FT                   GLGLDEFSMSASSILKSRSLIKRLDQSEMVKLAEEALNKSTAEEVVELVEKYTAE"
     MAKELKGIAA SDGIAIAKAY LLVEPDLSYE KTEVTDVESE VKRFESALEV SRTELSTIRE        60
     KAAKDLGEDK AQIFDAHLLV LNDPELTGPI EESIKNAKTN AETALQETTD MFIGMFESMD       120
     NEYMRERAAD IKDVRKRVLS HLLGVTIPNP ALIDEEVVVV AADLTPSDTA QLNRKFVKGF       180
     VTDIGGRTSH SAIMARSLEI PAVVGTKEVT ASVAKNDIVI IDGLEGNVII HPTEEQIAHY       240
     EKIKSDFALQ QAEWEKLKNE KTVSKDGVHV ELAANIGTPN DLEGVISNGG EAVGLYRTEF       300
     LYMGRDNFPT EEEQFEAYKA VVSGMDGKSV VVRTLDIGGD KTLPYLELPE EMNPFLGFRA       360
     IRLCFANEEL FRTQLRALLR ASVYGNLKIM FPMIATVNEF RQARDILLDE KAKLKAAGTE       420
     VSDSIELGIM IEIPAAAVLA DQFAKEVDFF SIGTNDLIQY TMAADRMNER VSYLYQPYNP       480
     SILRLVKMVI DASHKEGKWT GMCGEMAGDQ TAVPLLLGLG LDEFSMSASS ILKSRSLIKR       540
     LDQSEMVKLA EEALNKSTAE EVVELVEKYT AE                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page