(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1003

AL596167.LIN1003     Location/Qualifiers
FT   CDS             61618..62652
FT                   /transl_table=11
FT                   /gene="lin1003"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D18"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D18"
FT                   /protein_id="CAC96234.1"
FT                   /translation="MVIYSLAGFFLLLFIVLSFIDRRRISNGIVLTLALFFSLLSLIYV
FT                   TLSNGNELFVSIMSTVLILLFLLIPFFIIGLATTLIMNGRLMLKREGRKLANMLPLFIG
FT                   LVIVILFIFWFGSILKNGSPILGMVVVFVMAFVGYFSFLFLSFLLSTFLYQFNFPRYNQ
FT                   DFLIVLGSGLIDGDRVPPLLASRLNRAIAFYEKQYDKKGKRATFIVSGGQGANETVSEA
FT                   RAMRDYLISKGIDENFIIMEDKSVNTLQNMQFSKAKMDAIMPTYNSLFSTNNFHLFRAG
FT                   LYARKAGLKSQGIGAKTALYYMPNALIREFIAITVMYKKVHLILLGLVVLFFVFLAIIG
FT                   ITFR"
     MVIYSLAGFF LLLFIVLSFI DRRRISNGIV LTLALFFSLL SLIYVTLSNG NELFVSIMST        60
     VLILLFLLIP FFIIGLATTL IMNGRLMLKR EGRKLANMLP LFIGLVIVIL FIFWFGSILK       120
     NGSPILGMVV VFVMAFVGYF SFLFLSFLLS TFLYQFNFPR YNQDFLIVLG SGLIDGDRVP       180
     PLLASRLNRA IAFYEKQYDK KGKRATFIVS GGQGANETVS EARAMRDYLI SKGIDENFII       240
     MEDKSVNTLQ NMQFSKAKMD AIMPTYNSLF STNNFHLFRA GLYARKAGLK SQGIGAKTAL       300
     YYMPNALIRE FIAITVMYKK VHLILLGLVV LFFVFLAIIG ITFR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page