(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1004

AL596167.LIN1004     Location/Qualifiers
FT   CDS             62665..63525
FT                   /transl_table=11
FT                   /gene="lin1004"
FT                   /note="similar to 3-hydroxyisobutyrate dehydrogenase (B.
FT                   subtilis YkwC protein)"
FT                   /db_xref="GOA:Q92D17"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D17"
FT                   /protein_id="CAC96235.1"
FT                   /translation="MEKIGFVGTGVMGSSMAKHLLEAGYEVHIYTRTKEKAEALLSQGA
FT                   LWESDPGSLGAKVDILISMVGYPKDVEQLYLGENGFLDNLKAGSVAIDMTTSSPALAKK
FT                   IAEAGHEKGIGVLDAPVSGGDIGAKNGTLAIMVGGAEDVFLKVKPIFEILGSSVILQGD
FT                   AGSGQHTKMVNQIAIASNMIGVTEAIIYAERAGLNPSRVLDSISGGAAGSWSLTNLIPR
FT                   VLQDDFSPGFFIKHFIKDMGIALSEAKQMGLELPGLTLAEQMYQTLAEQGLSEEGTQAL
FT                   IKYYR"
     MEKIGFVGTG VMGSSMAKHL LEAGYEVHIY TRTKEKAEAL LSQGALWESD PGSLGAKVDI        60
     LISMVGYPKD VEQLYLGENG FLDNLKAGSV AIDMTTSSPA LAKKIAEAGH EKGIGVLDAP       120
     VSGGDIGAKN GTLAIMVGGA EDVFLKVKPI FEILGSSVIL QGDAGSGQHT KMVNQIAIAS       180
     NMIGVTEAII YAERAGLNPS RVLDSISGGA AGSWSLTNLI PRVLQDDFSP GFFIKHFIKD       240
     MGIALSEAKQ MGLELPGLTL AEQMYQTLAE QGLSEEGTQA LIKYYR                      286
//

If you have problems or comments...

PBIL Back to PBIL home page