(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1005

AL596167.LIN1005     Location/Qualifiers
FT   CDS             complement(63563..64708)
FT                   /transl_table=11
FT                   /gene="lin1005"
FT                   /note="similar to aminotransferases (to B. subtilis PatA
FT                   protein)"
FT                   /db_xref="GOA:Q92D16"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D16"
FT                   /protein_id="CAC96236.1"
FT                   /translation="MTKSIRPELRDIEVSGIRTFNTRVTGIPDMIRLTLGEPDFPTPEH
FT                   VKQAAITAIQENFTNYTPNAGMPELLEAASSYFEEKYDLTYSNKEIIVTVGATEAISVA
FT                   LQTILEPGDEVILPDPIYPGYEPLIKLNKARPVKVDTTESNFKLTPEQLRAHITPKTKA
FT                   LIIPYPSNPTGVSLSKQELRDLAEVLKETGIFVIADEIYSELTYHEEHVSIAPMLRDQT
FT                   IVINGLSKSHAMIGWRIGFLLAPEKITTEMLKIHQYSVTCASSISQKAALEAITNGKDD
FT                   AFQMRTEYKTRANFTQDRLEKMGFTVIPPDGAFYFFVKLPDDITENSFDWAVRLAEEAK
FT                   VAVVPGNAFSEKGDRYFRLSYATSVNNLAEALDRMAQFLAK"
     MTKSIRPELR DIEVSGIRTF NTRVTGIPDM IRLTLGEPDF PTPEHVKQAA ITAIQENFTN        60
     YTPNAGMPEL LEAASSYFEE KYDLTYSNKE IIVTVGATEA ISVALQTILE PGDEVILPDP       120
     IYPGYEPLIK LNKARPVKVD TTESNFKLTP EQLRAHITPK TKALIIPYPS NPTGVSLSKQ       180
     ELRDLAEVLK ETGIFVIADE IYSELTYHEE HVSIAPMLRD QTIVINGLSK SHAMIGWRIG       240
     FLLAPEKITT EMLKIHQYSV TCASSISQKA ALEAITNGKD DAFQMRTEYK TRANFTQDRL       300
     EKMGFTVIPP DGAFYFFVKL PDDITENSFD WAVRLAEEAK VAVVPGNAFS EKGDRYFRLS       360
     YATSVNNLAE ALDRMAQFLA K                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page