(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1007

AL596167.LIN1007     Location/Qualifiers
FT   CDS             65462..65695
FT                   /transl_table=11
FT                   /gene="lin1007"
FT                   /note="similar to B. subtilis YkuJ protein"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP14"
FT                   /protein_id="CAC96238.1"
FT                   /translation="MSQLLGIIQRLHAMQEDESAETQARRFEKNGTPVCEVKFFQASNS
FT                   FEVEIYGDNSKYQFDDIDMTAIEIFETLQENE"
     MSQLLGIIQR LHAMQEDESA ETQARRFEKN GTPVCEVKFF QASNSFEVEI YGDNSKYQFD        60
     DIDMTAIEIF ETLQENE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page