(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1008

AL596167.LIN1008     Location/Qualifiers
FT   CDS             65912..66364
FT                   /transl_table=11
FT                   /gene="lin1008"
FT                   /note="similar to B. subtilis YkuL protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D13"
FT                   /protein_id="CAC96239.1"
FT                   /translation="MISNRFGQFIDNELADSMISAEKVAHVQLGNNLEHALLVLTKCGY
FT                   SVIPVLDFEFKLHGLISAAMITDAILGLERIEFERLEDLKVEDVMQTDFPVIKDFNNNE
FT                   RIVRLLVDHPFVCVVDEDHHFEGIVTRRVVLKQVNRYIHLQVEENR"
     MISNRFGQFI DNELADSMIS AEKVAHVQLG NNLEHALLVL TKCGYSVIPV LDFEFKLHGL        60
     ISAAMITDAI LGLERIEFER LEDLKVEDVM QTDFPVIKDF NNNERIVRLL VDHPFVCVVD       120
     EDHHFEGIVT RRVVLKQVNR YIHLQVEENR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page