(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1011

AL596167.LIN1011     Location/Qualifiers
FT   CDS             68060..69175
FT                   /transl_table=11
FT                   /gene="lin1011"
FT                   /note="similar to N-acyl-L-amino acid amidohydrolases"
FT                   /db_xref="GOA:Q92D10"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D10"
FT                   /protein_id="CAC96242.1"
FT                   /translation="MLNEFIAIRRDLHQIPETGYKELKTQAYLLDYISKLPNEFLEIKK
FT                   WRTGILVLVKGTNPGKTIGYRTDIDALPITEETGLPFESKHAGNMHACGHDLHMSIALG
FT                   VLTHFASKPAKDNLLFVFQPAEEGPGGAKPIMESAEFSEWRPDTIYGLHIAPEYKVGQI
FT                   AIKPGLLFANTSELFISFKGKGGHAAYPHLANDMVVAASAFVGQMQTIISRNIDPMDSA
FT                   VITIGRIHGGEIQNVIAETAFLDGTIRTLSPETMEIVWTRLKQLAKGWEEAYQCEVEFH
FT                   PGSDYYQVDNDPVETEEFIHFLEEQYPESYVPARSAMTGEDFGYFLSEIKGFMFWLGVD
FT                   SEYSLHHAKLSPKEEAIPFAIDVLVNFLESK"
     MLNEFIAIRR DLHQIPETGY KELKTQAYLL DYISKLPNEF LEIKKWRTGI LVLVKGTNPG        60
     KTIGYRTDID ALPITEETGL PFESKHAGNM HACGHDLHMS IALGVLTHFA SKPAKDNLLF       120
     VFQPAEEGPG GAKPIMESAE FSEWRPDTIY GLHIAPEYKV GQIAIKPGLL FANTSELFIS       180
     FKGKGGHAAY PHLANDMVVA ASAFVGQMQT IISRNIDPMD SAVITIGRIH GGEIQNVIAE       240
     TAFLDGTIRT LSPETMEIVW TRLKQLAKGW EEAYQCEVEF HPGSDYYQVD NDPVETEEFI       300
     HFLEEQYPES YVPARSAMTG EDFGYFLSEI KGFMFWLGVD SEYSLHHAKL SPKEEAIPFA       360
     IDVLVNFLES K                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page