(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1012

AL596167.LIN1012     Location/Qualifiers
FT   CDS             complement(69220..70065)
FT                   /transl_table=11
FT                   /gene="lin1012"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YkuT protein"
FT                   /db_xref="GOA:Q92D09"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D09"
FT                   /protein_id="CAC96243.1"
FT                   /translation="MNLLKKWFSSIDWDQFWNHIISVGIKIAILIALYFIFRVVGNKII
FT                   RSFFRKYRQQQAVSVGRADTLESLISNFYGYVLFFTFAILLLQNFMDVTAIIASAGVAS
FT                   LAIAFGAQGLVSDVVTGFFILLERQLDVGDTITIGLVNGTVEALGLRTTQVRDFDGTLH
FT                   FIPNRQIMVVSNHSRGNMRVMVDIQISPHEDPEKAIKIIGEVCDVAAKENKNIVEPPVV
FT                   LGVQNIDATNMIIRVVGKAVNGEQYSVQRDLLKDIREALAENEIELPLNFVSTFGPNNN
FT                   "
     MNLLKKWFSS IDWDQFWNHI ISVGIKIAIL IALYFIFRVV GNKIIRSFFR KYRQQQAVSV        60
     GRADTLESLI SNFYGYVLFF TFAILLLQNF MDVTAIIASA GVASLAIAFG AQGLVSDVVT       120
     GFFILLERQL DVGDTITIGL VNGTVEALGL RTTQVRDFDG TLHFIPNRQI MVVSNHSRGN       180
     MRVMVDIQIS PHEDPEKAIK IIGEVCDVAA KENKNIVEPP VVLGVQNIDA TNMIIRVVGK       240
     AVNGEQYSVQ RDLLKDIREA LAENEIELPL NFVSTFGPNN N                           281
//

If you have problems or comments...

PBIL Back to PBIL home page