(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1016

AL596167.LIN1016     Location/Qualifiers
FT   CDS             73501..73992
FT                   /transl_table=11
FT                   /gene="lin1016"
FT                   /note="similar to phosphotransferase system
FT                   glucose-specific enzyme IIA "
FT                   /db_xref="GOA:Q92D05"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D05"
FT                   /protein_id="CAC96247.1"
FT                   /translation="MFKKFLKKSKNETVFAHVTGQLIALEDVPDPVFNQKMMGEGIAIK
FT                   PESGTIVAPVDGKIIQLAETKHAFGIRTDMGQEILVHIGLETVSLNGEGFNVLVNVGDK
FT                   VKVGDPIVEADFDFIKKNAASTVVPMVVTNSSEGKYDFEFAGTPNTVAGKTEVFTTNLI
FT                   "
     MFKKFLKKSK NETVFAHVTG QLIALEDVPD PVFNQKMMGE GIAIKPESGT IVAPVDGKII        60
     QLAETKHAFG IRTDMGQEIL VHIGLETVSL NGEGFNVLVN VGDKVKVGDP IVEADFDFIK       120
     KNAASTVVPM VVTNSSEGKY DFEFAGTPNT VAGKTEVFTT NLI                         163
//

If you have problems or comments...

PBIL Back to PBIL home page