(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1017

AL596167.LIN1017     Location/Qualifiers
FT   CDS             74105..74800
FT                   /transl_table=11
FT                   /gene="lin1017"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q92D04"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D04"
FT                   /protein_id="CAC96248.1"
FT                   /translation="MLEVIVQNPRDAYLAEKYGANRMEVVSAISEGGLTPSYGAIKEIV
FT                   RASKLPAMMMIRPHSFSFVYDEPARIVMERDIELAKEVGVKGIVYGGITEDGNIDQELL
FT                   EKVIEWKGDLDLTFHRALEATKDIEASYQVLRTYGQDINQLLTSGGTASALDSLPRLKR
FT                   WINDSKENPSSFKILVGSGVKPENIAIFQETLNHTDYHVGSAARETNDFAKDILKEKIN
FT                   ILKQHINQD"
     MLEVIVQNPR DAYLAEKYGA NRMEVVSAIS EGGLTPSYGA IKEIVRASKL PAMMMIRPHS        60
     FSFVYDEPAR IVMERDIELA KEVGVKGIVY GGITEDGNID QELLEKVIEW KGDLDLTFHR       120
     ALEATKDIEA SYQVLRTYGQ DINQLLTSGG TASALDSLPR LKRWINDSKE NPSSFKILVG       180
     SGVKPENIAI FQETLNHTDY HVGSAARETN DFAKDILKEK INILKQHINQ D                231
//

If you have problems or comments...

PBIL Back to PBIL home page