(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1018

AL596167.LIN1018     Location/Qualifiers
FT   CDS             74880..75752
FT                   /transl_table=11
FT                   /gene="lin1018"
FT                   /note="similar to B. subtilis YitL protein"
FT                   /db_xref="GOA:Q92D03"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D03"
FT                   /protein_id="CAC96249.1"
FT                   /translation="MNNYIGKSQVMTVKEIKETGWLLEKDEVTVFLSKSNTHETELAVG
FT                   DEVTAFIFVDYDREIRATTIIPKIQVGHYGWGTVTEVRKHLGVFVDIGIEKDVVVSLDD
FT                   LPALPHLWPKKEDRVMIALRVDEENRVWGVLAEEEQFRAIAVRADQDLFNQNVEGTIYR
FT                   LLKVGSFVFTDDFHIGFIHESERTAEPRMGERVKARVIAVKPDGSLNLSLRGRAHEVLN
FT                   DDAEMILTYLRSVGGEMPFGDKSDPDAIRAKFGISKAQFKRAIGTLLKARRITQENGVI
FT                   TKLTEEASD"
     MNNYIGKSQV MTVKEIKETG WLLEKDEVTV FLSKSNTHET ELAVGDEVTA FIFVDYDREI        60
     RATTIIPKIQ VGHYGWGTVT EVRKHLGVFV DIGIEKDVVV SLDDLPALPH LWPKKEDRVM       120
     IALRVDEENR VWGVLAEEEQ FRAIAVRADQ DLFNQNVEGT IYRLLKVGSF VFTDDFHIGF       180
     IHESERTAEP RMGERVKARV IAVKPDGSLN LSLRGRAHEV LNDDAEMILT YLRSVGGEMP       240
     FGDKSDPDAI RAKFGISKAQ FKRAIGTLLK ARRITQENGV ITKLTEEASD                  290
//

If you have problems or comments...

PBIL Back to PBIL home page