(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1019

AL596167.LIN1019     Location/Qualifiers
FT   CDS             75888..76601
FT                   /transl_table=11
FT                   /gene="lin1019"
FT                   /note="similar to B. subtilis YvqF protein"
FT                   /db_xref="GOA:Q92D02"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D02"
FT                   /protein_id="CAC96250.1"
FT                   /translation="MKKMESSVVFIFLIAIIVGVGLEMLFQWELLILFALGIFFIFTSR
FT                   KASATKKSAKNSLFIGIVFIIIAVLLTTTFKVGLVVAGIYAIIHYISRKRAPQLLMLKT
FT                   REPDSKIDRTGKFIRNQWFGNQRILDVVYEWDDINIQTGIGDTILDLGNTVLPTGESII
FT                   MIRSVSGKIRILVPFDIGICIEHSAIFGNIQYDKESTSIQNNSIKVYSDNYESSARKVK
FT                   IMTSVIFGDLEVIRL"
     MKKMESSVVF IFLIAIIVGV GLEMLFQWEL LILFALGIFF IFTSRKASAT KKSAKNSLFI        60
     GIVFIIIAVL LTTTFKVGLV VAGIYAIIHY ISRKRAPQLL MLKTREPDSK IDRTGKFIRN       120
     QWFGNQRILD VVYEWDDINI QTGIGDTILD LGNTVLPTGE SIIMIRSVSG KIRILVPFDI       180
     GICIEHSAIF GNIQYDKEST SIQNNSIKVY SDNYESSARK VKIMTSVIFG DLEVIRL          237
//

If you have problems or comments...

PBIL Back to PBIL home page