(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1020

AL596167.LIN1020     Location/Qualifiers
FT   CDS             76598..77656
FT                   /transl_table=11
FT                   /gene="lin1020"
FT                   /note="similar to two-component sensor histidine kinase in
FT                   particular B. subtilis YvqE protein"
FT                   /db_xref="GOA:Q92D01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D01"
FT                   /protein_id="CAC96251.1"
FT                   /translation="MSFSKLMMVVCSGLLLVATAIGTVGYYFFSEGSWYKILIEQKIFY
FT                   IPFIVFVPLTAISIGLIIGGLLGYFVKQKFESIDFSIRLLGQGDLEKKITSEEDETFLE
FT                   VQQVYKQIDRLRDKMKAQTILTQKLASDRAESSGQTKEAILSEERHRIARELHDSVSQQ
FT                   LFAAMMLLSALNEQSEKSATPAMQKQLKMVESIVNESQSEMRALLLHLRPTQLEGKSLK
FT                   TGIEQLLKELTTKLPIEVEWQIEDINLQKGIEDHLFRIVQELLSNTLRHSKAKLLEVRL
FT                   VTMDNLAVMKVVDDGVGFDMDNVRQGSYGLQNMRERVAEFGGTIKIISFKGRGTSVEIK
FT                   IPLVAKKDVENE"
     MSFSKLMMVV CSGLLLVATA IGTVGYYFFS EGSWYKILIE QKIFYIPFIV FVPLTAISIG        60
     LIIGGLLGYF VKQKFESIDF SIRLLGQGDL EKKITSEEDE TFLEVQQVYK QIDRLRDKMK       120
     AQTILTQKLA SDRAESSGQT KEAILSEERH RIARELHDSV SQQLFAAMML LSALNEQSEK       180
     SATPAMQKQL KMVESIVNES QSEMRALLLH LRPTQLEGKS LKTGIEQLLK ELTTKLPIEV       240
     EWQIEDINLQ KGIEDHLFRI VQELLSNTLR HSKAKLLEVR LVTMDNLAVM KVVDDGVGFD       300
     MDNVRQGSYG LQNMRERVAE FGGTIKIISF KGRGTSVEIK IPLVAKKDVE NE               352
//

If you have problems or comments...

PBIL Back to PBIL home page