(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1021

AL596167.LIN1021     Location/Qualifiers
FT   CDS             77653..78291
FT                   /transl_table=11
FT                   /gene="lin1021"
FT                   /note="similar to two-component response regulator, in
FT                   particular B. subtilis YvqC protein"
FT                   /db_xref="GOA:Q92D00"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D00"
FT                   /protein_id="CAC96252.1"
FT                   /translation="MIKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAENGREGADMALE
FT                   LRPDIILMDLVMDEMDGIEATKEIMKNWKEAKIIIVTSFIDDEKVYPALEAGASSYMLK
FT                   TSTASEIADAIRATYGGDSVLEPEVTGKMMQRLTAKPEKNLHDDLTNRENEILLLIAEG
FT                   KSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLVEKK"
     MIKVLLVDDH EMVRIGVSAY LSVQDDMEVV GEAENGREGA DMALELRPDI ILMDLVMDEM        60
     DGIEATKEIM KNWKEAKIII VTSFIDDEKV YPALEAGASS YMLKTSTASE IADAIRATYG       120
     GDSVLEPEVT GKMMQRLTAK PEKNLHDDLT NRENEILLLI AEGKSNQEIA DELFITLKTV       180
     KTHVSNILSK LDVQDRTQAA IYAFKHDLVE KK                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page