(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1025

AL596167.LIN1025     Location/Qualifiers
FT   CDS             complement(80926..81891)
FT                   /transl_table=11
FT                   /gene="lin1025"
FT                   /note="similar to B. subtilis LytR protein"
FT                   /db_xref="GOA:Q92CZ6"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="PDB:3OWQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ6"
FT                   /protein_id="CAC96256.1"
FT                   /translation="MTETRTETKQKKPSTFTKVMKIASVTLLGILFFSITGLAAKYYIT
FT                   VQNTFTKINVPLETSNKTTSDLEKKKPFSVLLMGSDARPGETNGRADTIILATANKQQN
FT                   AVEMVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLMPGVPVDYFISINMEGF
FT                   KDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTDALQYVRIRHEDPRGDFGRQDRQR
FT                   DVIIGIANKVISSSGVSNFESIMKAVGDNFQTNMTLTDITSMATNYSSVLKNVDSQELK
FT                   GEGEMIYSESYGFDLYYFAPDETDLERVINMFKKSLDITE"
     MTETRTETKQ KKPSTFTKVM KIASVTLLGI LFFSITGLAA KYYITVQNTF TKINVPLETS        60
     NKTTSDLEKK KPFSVLLMGS DARPGETNGR ADTIILATAN KQQNAVEMVS IPRDTKVDYG       120
     NGDIGKINAS YSNGGPSGTV SAVEKLMPGV PVDYFISINM EGFKDLVDAV GGITVYNDID       180
     LTEVNSKFVK GNITLNGTDA LQYVRIRHED PRGDFGRQDR QRDVIIGIAN KVISSSGVSN       240
     FESIMKAVGD NFQTNMTLTD ITSMATNYSS VLKNVDSQEL KGEGEMIYSE SYGFDLYYFA       300
     PDETDLERVI NMFKKSLDIT E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page