(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1027

AL596167.LIN1027     Location/Qualifiers
FT   CDS             complement(83674..83883)
FT                   /transl_table=11
FT                   /gene="lin1027"
FT                   /note="similar to B. subtilis YkzG protein"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AP11"
FT                   /protein_id="CAC96258.1"
FT                   /translation="MIFKVFYQETLTETPVREKTQSLYVEAESEVKVRQLLKDEPFHIE
FT                   FVEKISDAHLAYEKENPDFALWEK"
     MIFKVFYQET LTETPVREKT QSLYVEAESE VKVRQLLKDE PFHIEFVEKI SDAHLAYEKE        60
     NPDFALWEK                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page