(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1029

AL596167.LIN1029     Location/Qualifiers
FT   CDS             complement(85165..85968)
FT                   /transl_table=11
FT                   /gene="lin1029"
FT                   /note="highly similar to B. subtilis YoaT protein"
FT                   /db_xref="GOA:Q92CZ2"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ2"
FT                   /protein_id="CAC96260.1"
FT                   /translation="MKFFRLLWVFTWKQALCCLFPGIIFISLALTKLIEIPFIARYDLL
FT                   LIICLVTQIFLIKFGLETWDELKVIMIFHLIGLGLEIYKVHMGSWSYPEPGLMKLFGVP
FT                   LYSGFMYSSVASYICQAWKRFDLNMTNWPNIWLVSSLCIAIYANFFTHHFIMDFRWILI
FT                   ILVLLLFRKTYVYFKVSATQLKMPLSFSFLCIAFFIYLAENIASFYGAWAYPDQLVAWR
FT                   PVHVSKITSWYLLVIISIIIVAQLKFIKQKWEQDQITTKSEATLK"
     MKFFRLLWVF TWKQALCCLF PGIIFISLAL TKLIEIPFIA RYDLLLIICL VTQIFLIKFG        60
     LETWDELKVI MIFHLIGLGL EIYKVHMGSW SYPEPGLMKL FGVPLYSGFM YSSVASYICQ       120
     AWKRFDLNMT NWPNIWLVSS LCIAIYANFF THHFIMDFRW ILIILVLLLF RKTYVYFKVS       180
     ATQLKMPLSF SFLCIAFFIY LAENIASFYG AWAYPDQLVA WRPVHVSKIT SWYLLVIISI       240
     IIVAQLKFIK QKWEQDQITT KSEATLK                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page