(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1030

AL596167.LIN1030     Location/Qualifiers
FT   CDS             complement(86035..86616)
FT                   /transl_table=11
FT                   /gene="lin1030"
FT                   /note="weakly similar to molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="GOA:Q92CZ1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ1"
FT                   /protein_id="CAC96261.1"
FT                   /translation="MKNAKVNVGIVLAGGKSSRFGKSKALFQNEATGKTWVELTVNKLK
FT                   PFCEMVFVSANQENYQKLIALFHEDSAIQIIPDQPAYKDFGPLGGIYAVMVQKNAYPEA
FT                   NYLILPVDMPFLTSSEISRLAAFPNHFAKTAEENHYLVLNIPYSREILHNLLQKEQHRV
FT                   RGLLEKLQTKPLEFENEAPFTNINRQNELF"
     MKNAKVNVGI VLAGGKSSRF GKSKALFQNE ATGKTWVELT VNKLKPFCEM VFVSANQENY        60
     QKLIALFHED SAIQIIPDQP AYKDFGPLGG IYAVMVQKNA YPEANYLILP VDMPFLTSSE       120
     ISRLAAFPNH FAKTAEENHY LVLNIPYSRE ILHNLLQKEQ HRVRGLLEKL QTKPLEFENE       180
     APFTNINRQN ELF                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page