(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1031

AL596167.LIN1031     Location/Qualifiers
FT   CDS             complement(86597..87259)
FT                   /transl_table=11
FT                   /gene="lin1031"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q92CZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ0"
FT                   /protein_id="CAC96262.1"
FT                   /translation="MLRLQFHKKLPFHDLNIDYTFEKPVTAMMGASGSGKSTLFQCVSG
FT                   LKSIDGGIIEFDGTPWDDSNISLHLPVTERKVGYLFQNLALFPNMNVYENIAFGLKVKK
FT                   KKKKEQAEIQQQVRKMSDYLQISHLLYSSVQKLSGGEKQRVAMARAMITEPKLLLLDEP
FT                   FNGLDEETRLICMKLVGQMAKDFHIPVIFVTHYASEAEMMTEEILVMRDGRLEKRKS"
     MLRLQFHKKL PFHDLNIDYT FEKPVTAMMG ASGSGKSTLF QCVSGLKSID GGIIEFDGTP        60
     WDDSNISLHL PVTERKVGYL FQNLALFPNM NVYENIAFGL KVKKKKKKEQ AEIQQQVRKM       120
     SDYLQISHLL YSSVQKLSGG EKQRVAMARA MITEPKLLLL DEPFNGLDEE TRLICMKLVG       180
     QMAKDFHIPV IFVTHYASEA EMMTEEILVM RDGRLEKRKS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page