(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1033

AL596167.LIN1033     Location/Qualifiers
FT   CDS             88041..88814
FT                   /transl_table=11
FT                   /gene="lin1033"
FT                   /note="similar to molybdate ABC transporter binding
FT                   protein"
FT                   /db_xref="GOA:Q92CY8"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY8"
FT                   /protein_id="CAC96264.1"
FT                   /translation="MKKIAILISCLLVLLVGACANTSEKAKTTTTIHISAAASLKDTMD
FT                   DVKPLFEKAYPSIKLSFDFGGSGQIRERVESGAPIDGVLLASKKDADTLSNQKLAENTK
FT                   EFAGNDLVLIEPKNADQKEGLSLEQLLDNADKIAIGDPESVPAGAYAKQTLGNLNLYNT
FT                   EKAKLVLATDVRQVLSYVEAGNADAGFVYQTDAILSKKVQVKAKIDAKLHDPIAYYSAQ
FT                   VTDSEKKEPTTTFLDFMNKSEAQKILEKYGFKAAD"
     MKKIAILISC LLVLLVGACA NTSEKAKTTT TIHISAAASL KDTMDDVKPL FEKAYPSIKL        60
     SFDFGGSGQI RERVESGAPI DGVLLASKKD ADTLSNQKLA ENTKEFAGND LVLIEPKNAD       120
     QKEGLSLEQL LDNADKIAIG DPESVPAGAY AKQTLGNLNL YNTEKAKLVL ATDVRQVLSY       180
     VEAGNADAGF VYQTDAILSK KVQVKAKIDA KLHDPIAYYS AQVTDSEKKE PTTTFLDFMN       240
     KSEAQKILEK YGFKAAD                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page