(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1034

AL596167.LIN1034     Location/Qualifiers
FT   CDS             88909..90132
FT                   /transl_table=11
FT                   /gene="lin1034"
FT                   /note="similar to molybdopterin biosynthesis protein moeA"
FT                   /db_xref="GOA:Q92CY7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY7"
FT                   /protein_id="CAC96265.1"
FT                   /translation="MIEKRNTIRMEQAREVLCNQITHLPVERKNVTEALNQVLQEPIFA
FT                   PFPAPYFRRSGYDGFAITEEDDGNYPITLHVVAEVPCGKTYDKPLKPGETVRIMTGAKV
FT                   PDNASKIIMLEQSREAENKNDIVLINTQKSSNITEIGAEFAKGDLLLDRGHTLNAGSIS
FT                   LLSSFGISEVQVIRKPKVAILSTGSELVPAGNSLPDGKIYNSNQPLLENLLTVHHAEIC
FT                   AAEQLPDNYEDTKARLLELTKIADLIVTTGGVSVGDYDFMADIAKQEAELLFNKIQMRP
FT                   GSPTTGMWLNKTLIIALSGNPGACFTGFYLLVEPVLATFMGKDNTATTKVRAKMASDYT
FT                   KNNGFDRFLRGTYHLSEEGEYLVELVGSDMSSALGNLHLTTCLFKIPGGKVGKYQGEEV
FT                   EAWLLSSK"
     MIEKRNTIRM EQAREVLCNQ ITHLPVERKN VTEALNQVLQ EPIFAPFPAP YFRRSGYDGF        60
     AITEEDDGNY PITLHVVAEV PCGKTYDKPL KPGETVRIMT GAKVPDNASK IIMLEQSREA       120
     ENKNDIVLIN TQKSSNITEI GAEFAKGDLL LDRGHTLNAG SISLLSSFGI SEVQVIRKPK       180
     VAILSTGSEL VPAGNSLPDG KIYNSNQPLL ENLLTVHHAE ICAAEQLPDN YEDTKARLLE       240
     LTKIADLIVT TGGVSVGDYD FMADIAKQEA ELLFNKIQMR PGSPTTGMWL NKTLIIALSG       300
     NPGACFTGFY LLVEPVLATF MGKDNTATTK VRAKMASDYT KNNGFDRFLR GTYHLSEEGE       360
     YLVELVGSDM SSALGNLHLT TCLFKIPGGK VGKYQGEEVE AWLLSSK                     407
//

If you have problems or comments...

PBIL Back to PBIL home page