(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1036

AL596167.LIN1036     Location/Qualifiers
FT   CDS             90593..91015
FT                   /transl_table=11
FT                   /gene="lin1036"
FT                   /note="similar to molybdopterin converting factor, subunit
FT                   2"
FT                   /db_xref="GOA:Q92CY5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY5"
FT                   /protein_id="CAC96267.1"
FT                   /translation="MKYVALQHEKIEIGPLSEKLINKNHGGINLFVGTIREWTGDIQTE
FT                   EIRYTAYEAMALKELNKLATEVETKWGADVVIVHRLGLLEITDIAVFIGVSTPHRAACY
FT                   EGSRYIIERLKERVPIWKEEKDVDQIRWGGIDAHNG"
     MKYVALQHEK IEIGPLSEKL INKNHGGINL FVGTIREWTG DIQTEEIRYT AYEAMALKEL        60
     NKLATEVETK WGADVVIVHR LGLLEITDIA VFIGVSTPHR AACYEGSRYI IERLKERVPI       120
     WKEEKDVDQI RWGGIDAHNG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page