(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1037

AL596167.LIN1037     Location/Qualifiers
FT   CDS             90999..91247
FT                   /transl_table=11
FT                   /gene="lin1037"
FT                   /note="similar to molybdopterin converting factor (subunit
FT                   1)."
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY4"
FT                   /protein_id="CAC96268.1"
FT                   /translation="MLTTVKFFAFLAEKTKQTEVKLNLQQCETVGEVREVISSEFPEIA
FT                   VDLATCMLAVNMEFQHDQDILPNEITEIAVIPPVSGG"
     MLTTVKFFAF LAEKTKQTEV KLNLQQCETV GEVREVISSE FPEIAVDLAT CMLAVNMEFQ        60
     HDQDILPNEI TEIAVIPPVS GG                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page