(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1038

AL596167.LIN1038     Location/Qualifiers
FT   CDS             91260..91742
FT                   /transl_table=11
FT                   /gene="lin1038"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="GOA:Q92CY3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CY3"
FT                   /protein_id="CAC96269.1"
FT                   /translation="MDKDDLTHFNDEKRAKMVDVTSKSETKRRAIARATIHMNEETLAR
FT                   IHAGKIAKGDVLAVAQVAGIMAAKKTSELIPMCHPIMTTKADISFDDDGKTALTITSEV
FT                   VTVGKTGVEMEALTAVTIAALTIYDMCKAMDKGMQIEKTYLVEKTGGKSGTFKAEA"
     MDKDDLTHFN DEKRAKMVDV TSKSETKRRA IARATIHMNE ETLARIHAGK IAKGDVLAVA        60
     QVAGIMAAKK TSELIPMCHP IMTTKADISF DDDGKTALTI TSEVVTVGKT GVEMEALTAV       120
     TIAALTIYDM CKAMDKGMQI EKTYLVEKTG GKSGTFKAEA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page