(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1039

AL596167.LIN1039     Location/Qualifiers
FT   CDS             91771..92772
FT                   /transl_table=11
FT                   /gene="lin1039"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="GOA:Q92CY2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CY2"
FT                   /protein_id="CAC96270.1"
FT                   /translation="MQLLKDKFGRVHDYIRISVTDRCNLRCVYCMPEEGLTFLPHEKVL
FT                   SKDEIVSFMELMVKFGIKKVRITGGEPLLRTDIVEIVRGLGAIPEIEDISITTNAMYLA
FT                   KKAEALKEAGLTRVNISLDSLHADRFQAITRGGRLQKVLDGIQKAEEVGLFPIKLNVVL
FT                   IKGQNDDEITDFLQFTKDKDINIRFIEYMPIGHAGTSWKEKYLPLDTIFKACDDASFEY
FT                   EPVDSIRGNGPSENFRIKGAKGTFGVIHPVSAHFCDSCNRLRLTADGYIKACLYWDEEM
FT                   NIRPFIHEPVKLMQLVQKAIDNKPENHEMALKLQDEVQSNKPTWRRMSQIGG"
     MQLLKDKFGR VHDYIRISVT DRCNLRCVYC MPEEGLTFLP HEKVLSKDEI VSFMELMVKF        60
     GIKKVRITGG EPLLRTDIVE IVRGLGAIPE IEDISITTNA MYLAKKAEAL KEAGLTRVNI       120
     SLDSLHADRF QAITRGGRLQ KVLDGIQKAE EVGLFPIKLN VVLIKGQNDD EITDFLQFTK       180
     DKDINIRFIE YMPIGHAGTS WKEKYLPLDT IFKACDDASF EYEPVDSIRG NGPSENFRIK       240
     GAKGTFGVIH PVSAHFCDSC NRLRLTADGY IKACLYWDEE MNIRPFIHEP VKLMQLVQKA       300
     IDNKPENHEM ALKLQDEVQS NKPTWRRMSQ IGG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page