(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1040

AL596167.LIN1040     Location/Qualifiers
FT   CDS             complement(92805..93293)
FT                   /transl_table=11
FT                   /gene="lin1040"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   B"
FT                   /db_xref="GOA:Q92CY1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY1"
FT                   /protein_id="CAC96271.1"
FT                   /translation="MEQKTFIKVTCSILTISDTRNLETDTSGKLIQSLLEAAGHQVITR
FT                   VIVPDDAPRIKQEMDKLAANGSFCLITNGGTGIAKRDVTYEALFATIQQEIPGFGEIFR
FT                   MLSYEEVGSRAMVSRAFAGFSKSGLLIFALPGSSNASRLATEKLIIPELPHLIAERQK"
     MEQKTFIKVT CSILTISDTR NLETDTSGKL IQSLLEAAGH QVITRVIVPD DAPRIKQEMD        60
     KLAANGSFCL ITNGGTGIAK RDVTYEALFA TIQQEIPGFG EIFRMLSYEE VGSRAMVSRA       120
     FAGFSKSGLL IFALPGSSNA SRLATEKLII PELPHLIAER QK                          162
//

If you have problems or comments...

PBIL Back to PBIL home page