(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1041

AL596167.LIN1041     Location/Qualifiers
FT   CDS             complement(93305..94303)
FT                   /transl_table=11
FT                   /gene="lin1041"
FT                   /note="similar to molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="GOA:Q92CY0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY0"
FT                   /protein_id="CAC96272.1"
FT                   /translation="MERYDRQMRVANIGEIGQEKLLSKTILIVGVGAIGSYAAEICARM
FT                   GFGKLILIDRDYVELSNLQRQSLYTEQDALEKQAKAYAAQKAILLINSEIEVEYIVDDA
FT                   NMTSLTPFAKKIDYILDCTDNFMTRDFLNQFCFIHQIPWIFTSCAGNYANLMPITPPDS
FT                   ACLHCLLGDIPQTNAASCDIIGVDGALIPMVAGMQVSLLTQMILNPDFTANTYYQIDNW
FT                   QLNFQSLAVKKRPHCTGCSPEKVLSEVPFSEQTIALCGRDTVQFHLQNKSNYREIKQRL
FT                   AEQKMLYTENPALLSFNYEKYQFVIFKNGRVLLHGTENLAEAKKIYQLFFN"
     MERYDRQMRV ANIGEIGQEK LLSKTILIVG VGAIGSYAAE ICARMGFGKL ILIDRDYVEL        60
     SNLQRQSLYT EQDALEKQAK AYAAQKAILL INSEIEVEYI VDDANMTSLT PFAKKIDYIL       120
     DCTDNFMTRD FLNQFCFIHQ IPWIFTSCAG NYANLMPITP PDSACLHCLL GDIPQTNAAS       180
     CDIIGVDGAL IPMVAGMQVS LLTQMILNPD FTANTYYQID NWQLNFQSLA VKKRPHCTGC       240
     SPEKVLSEVP FSEQTIALCG RDTVQFHLQN KSNYREIKQR LAEQKMLYTE NPALLSFNYE       300
     KYQFVIFKNG RVLLHGTENL AEAKKIYQLF FN                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page