(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1042

AL596167.LIN1042     Location/Qualifiers
FT   CDS             94440..94991
FT                   /transl_table=11
FT                   /gene="lin1042"
FT                   /note="similar to B. subtilis YdfE protein"
FT                   /db_xref="GOA:Q92CX9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX9"
FT                   /protein_id="CAC96273.1"
FT                   /translation="MKKKLDTTKFYPAYPVFLLTYLNELGEAQMSTGSSSYTLGDTLVI
FT                   GISAESNASNYLKPGEKFAVNFPTTKQFDLIEQGGFSSGKRIDKVKEYQIELTKSESGA
FT                   LYIDSCPIIFECTVGQTIRDADYHTVFAKIDTRLMEETLIDTAGNFVHDELDLVLFSGD
FT                   AYERKFRKLDIKIEKVGGHL"
     MKKKLDTTKF YPAYPVFLLT YLNELGEAQM STGSSSYTLG DTLVIGISAE SNASNYLKPG        60
     EKFAVNFPTT KQFDLIEQGG FSSGKRIDKV KEYQIELTKS ESGALYIDSC PIIFECTVGQ       120
     TIRDADYHTV FAKIDTRLME ETLIDTAGNF VHDELDLVLF SGDAYERKFR KLDIKIEKVG       180
     GHL                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page