(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1043

AL596167.LIN1043     Location/Qualifiers
FT   CDS             complement(95038..95589)
FT                   /transl_table=11
FT                   /gene="lin1043"
FT                   /note="similar to formylmethionine deformylase and to B.
FT                   subtilis YkrB protein"
FT                   /db_xref="GOA:Q92CX8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CX8"
FT                   /protein_id="CAC96274.1"
FT                   /translation="MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGHDMLEFLINSQ
FT                   DEELAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACL
FT                   SGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVVQHEIDHLNGVMF
FT                   YDHINKENPSYLPPDVDVFG"
     MLTMDDIVRE GHPALREVAT EVTFPLSDEE KKLGHDMLEF LINSQDEELA EKYGLRGGVG        60
     IAAPQLAVTK RFLAIHVHDE KDRLYSYVLY NPKIRSHSVQ QACLSGGEGC LSVDREVPGY       120
     VVRSERVTID AFDENGTPLK LRFKGYPAIV VQHEIDHLNG VMFYDHINKE NPSYLPPDVD       180
     VFG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page