(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1050

AL596167.LIN1050     Location/Qualifiers
FT   CDS             103248..103520
FT                   /transl_table=11
FT                   /gene="lin1050"
FT                   /note="similar to B. subtilis YktA protein"
FT                   /db_xref="InterPro:IPR007920"
FT                   /db_xref="InterPro:IPR023324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67357"
FT                   /protein_id="CAC96281.1"
FT                   /translation="MEYSYPLNPDWTTEEMTIVVQFLEAIERAYEKGIDTLELKEKYRA
FT                   FKQVVPAKGEEKRIGIDFEKASGYSAYKVMQLVKNATTSKIKMQP"
     MEYSYPLNPD WTTEEMTIVV QFLEAIERAY EKGIDTLELK EKYRAFKQVV PAKGEEKRIG        60
     IDFEKASGYS AYKVMQLVKN ATTSKIKMQP                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page