(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1053

AL596167.LIN1053     Location/Qualifiers
FT   CDS             complement(105267..105881)
FT                   /transl_table=11
FT                   /gene="lin1053"
FT                   /note="similar to B. subtilis YktB protein"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CW8"
FT                   /protein_id="CAC96284.1"
FT                   /translation="MTFKGFSKKDFKTMQIPGLDARMAGIQNDIQPKFKAVGEELTTYL
FT                   SAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFI
FT                   YENEESTKIANRFLKEKKLLAELPDTFAISPDHTEEKTYPVHGGQLDATLKRFRDVKKG
FT                   EFLVGKIYLPDDNHLSPGKDFIKEAEMVLDELIPLYKAALQ"
     MTFKGFSKKD FKTMQIPGLD ARMAGIQNDI QPKFKAVGEE LTTYLSAKLG DEMFLHIARH        60
     QRRSVNPPES TWLAICHDKR GYKKHPHFQV GLFDNYLFIW LAFIYENEES TKIANRFLKE       120
     KKLLAELPDT FAISPDHTEE KTYPVHGGQL DATLKRFRDV KKGEFLVGKI YLPDDNHLSP       180
     GKDFIKEAEM VLDELIPLYK AALQ                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page