(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1054

AL596167.LIN1054     Location/Qualifiers
FT   CDS             106013..106786
FT                   /transl_table=11
FT                   /gene="lin1054"
FT                   /note="similar to extragenic suppressor protein SuhB and to
FT                   myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="GOA:Q92CW7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW7"
FT                   /protein_id="CAC96285.1"
FT                   /translation="MDSEKIDYLARLWIMEAAAKIKQSFKETLDIDIKSGRNDLVTNMD
FT                   KETEAFFVKQIKDHFPNHRLFGEEGMSDDVTDLNGIVWILDPIDGTLNFVEQQRDFAIS
FT                   LAIYQDGVGHLAYIYDVTRDELYFAEKGKGATVNGKQIPKIDKDMDLQDALLIANLSVT
FT                   RKFPTMWEAVKVSRGLRLHGAASLEYMDVATGRAGAYLSANLAPWDIAAGKIIVEELGG
FT                   IVTRIDGSKINMLEKGSSIVATPKIHQTLLDNYLP"
     MDSEKIDYLA RLWIMEAAAK IKQSFKETLD IDIKSGRNDL VTNMDKETEA FFVKQIKDHF        60
     PNHRLFGEEG MSDDVTDLNG IVWILDPIDG TLNFVEQQRD FAISLAIYQD GVGHLAYIYD       120
     VTRDELYFAE KGKGATVNGK QIPKIDKDMD LQDALLIANL SVTRKFPTMW EAVKVSRGLR       180
     LHGAASLEYM DVATGRAGAY LSANLAPWDI AAGKIIVEEL GGIVTRIDGS KINMLEKGSS       240
     IVATPKIHQT LLDNYLP                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page